1. Notes: 3 / 3 months ago 
    [Flash 10 is required to watch video]

    My friends and I are currently developing a 3d game, and I was assigned to create the characters.

    This is one of the practice models. Actually, this is the first time I ever finished an animation sequence. Haha!

  2. Notes

    1. shuttermemory posted this
avatar_128
 
 
Photography, Music, Bowling and Arts. Hi, there! My name is Chabs, and this is my story.

I have been breathing for 21 years since April 25, 1990, and standing tall at the soil of the Philippines. A graduate of B.S. Computer Science at the arms of the University of the East. I'm a musician, a photographer, an athlete and a frustrated writer. You're welcome to stay as long as you want but please, respect this place on the internet. Okay? :)

"Anyone can freeze time, just take a photograph!"
 
 

Links

The Other Side
Photographs and Memories
Facebook
Deviant Art

Make my Day!

Following

martinamartinanagparayahappyterbeben-elebenyoursweetgirlangelandaluzlulz-timecheselifyfabuleux-xokunwaridalagafvcktalyathelimitishighasthe-skychelaymahalayforeversabawnostalgicallyjadedtonyontheradiobeausteffylovequotesruskimjonghealthymakemestfushower-me-with-your-tearskittzzjoannapascualshythiswayselyangwolvesgonewildpiyaisapiyayaikaanimnghunyoloveagirlwhoreadsnixsayoiibigmuliprocrastinatorkeisisinteyadyandurianheckyeahsolennheussaffpsycholustputograftwintersanarchy152mmddanasaurrsssleepingheartprekprekvinquilopsugarcoatedrealitiesawdasdfghjkleccentriclittlemisswalangkausapronabeefckyeahcutecoupleskrizkotvsuperjollygreengiantwongfuproductionsinbulletsangbabaenglaginggutomfuckyeahfinalfantasymusicmegustamemesupdharmadownicanreadyangarciakevstaarrxakioxjjooaanndeeyosaanimalstalkinginallcapsakinkanalangkasikneehowmavideogamenostalgiathejollyjecaamateurdreameroldsummerskyisadalawatatlolightphotoshilarionheydreaaaonetwo-onenine-oneoneepicnephrinehelgaholicyourseventhheavennagmumunimunia-shot-of-enciferanythingblogsbipolarnursewordsliveonstroberisheykpurplefurmargaritaqueenomgheethegreatestpoeticallydumbmiseriadulcel0veanneohyessnikijessicamaekehstelabelaaaleilennybyelledgquote-booktinyfactsdavidkari-shmafromme-toyouangboyfriendmopinakbethstaffsuperememahiccuptoecstasyczarinalazaroiamsupercathireallylovepurplekaamiilleesidavidsorianoihavefounditohkellyliciousdiaryngtamadthevinchcoffeemondeetoursporsheohporshesneakpeeeekeatprayblogfinalfantasythingsmischemuffinjunsabaytoniamsexybitchydyakiiramonbautistatriciawillgoplacesohwowlunacinnamonpaujustatemycookie-cookiemonstaahchelseakeithsugarfreeyemacaptaingelaiprettyfoodstakemetoinfinityandbeyondversiclesrainbowcinnamonbongariannecoy-placidogmadrianosarahfigythedreamerdiaryrobchamfranzlyravailsuperheroatnightimsuperaceparisiandreamsxxtherizromerocomicsbygiosdesktumblr3dtheallyeezylatenightepisodesnikitalimpearlnapearlthepearlsaabmagalonapaolobadongyoumakemewannaaaiah17mishiieesunshinedarling22cheadela11seraphimponkanponkanhollaqueendabril-ni-duanemichellehoneygrooveshakerbanini-cakejustcallmetinepinoyrocknekkicolumnersmazylelixheyfreddotearswontworkkkpelikulatalesofromeodeaqueuekiminitodokelovelookandlookagainheartbreakrrrraphaellefernandezmzamor012es2pidoiscreamlikeamaniacnicolandiaintuition-linesburn2dethlurvejenaielapsedmemories500daysofkissingmypillowchekasnoberaanttwokeenlexpotomarksaldanapixelatedtimesuperismuhhhpuhlinekrispancitarianmimeehantidoteifreakingloveyouinnahcartelchiksilogfreckledfaceofkimkokonatmanthumbsuck09shuttersandfstopseuricharmedkindlersupah-girlfuckyeahidiomsyahjechiekaaetherbornworldcitizenshekelaylolaymesheystrippermakemegoodgod-butnotyetanythingpopsjustkeepscrolliiingmajomajomajooodamslyslumberloverprettyysababyluckymaeexxxannnaxxxarmadominnie-cloudy-rainiekeithinlovepolappolintandaily-memesimmakhalifafosheezygoldiezeemarjoy788pulangtansanoldderangedwriterputridcheeseangdakilanggagabelswhydontwedoitinadraftingroomigivemyfirstlovetoyoujeffreeeyyycupofcappuccinofirstacademyofcomputerartsciitphilippinesthisisnotactiveianpasicolanmendozalhynneanjdesphotographyicarus05henerosobistokyacamerapokpokbrendaisherewillbebacksoonhopefullychaoasilo0911yuwieejoannelagunakiko2108itscharm25kiminitodokegifsfafabillycoyjeansaranghaeblogconfessiongdarwinggeorgesmischiefdynaceedecembersvillefaradaygermaineuangmakesoboydearlittleonechildishdreamsmanchipants15momomoldubiousmejdcabreramichiko11thefrustratedastronautchaspeaksoutawesomegiirlmakemeroflfalloutboyyypoopstartakethemickeyresterdelarmentepsychogeekroandeedigradiomimilabsuohio37anjdesbolinasyeye-rnkholangotzcrushesreeeighnkukurukutetmarilexjeanclangpadillachaoheartsyou
 

Tumblr